Iright
BRAND / VENDOR: Proteintech

Proteintech, 14166-1-AP, PTH2R Polyclonal antibody

CATALOG NUMBER: 14166-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTH2R (14166-1-AP) by Proteintech is a Polyclonal antibody targeting PTH2R in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14166-1-AP targets PTH2R in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, BxPC-3 cells, human testis tissue, mouse liver tissue, mouse pancreas tissue, mouse testis tissue Positive IHC detected in: human pancreas cancer tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Parathyroid hormone 2 receptor (PTH2R, also known as PTHR2) is a member of the secretin receptor family of G protein-coupled receptors. PTH2R selectively recognizes parathyroid hormone and is particularly abundant in the brain and pancreas (PMID: 7797535). Tuberoinfundibular peptide of 39 residues (TIP39) is the endogenous ligand of the PTH2R in the brain, and they form a neuromodulator system (PMID: 19857544). PTH2R is involved in the regulation of calcium transport, nociception mediation, and wound healing (PMID: 34353904). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5364 Product name: Recombinant human PTH2R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 419-550 aa of BC036811 Sequence: EVQAEVKKMWSRWNLSVDWKRTPPCGSRRCGSVLTTVTHSTSSQSQVAASTRMVLISGKAAKIASRQPDSHITLPGYVWSNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETEDVL Predict reactive species Full Name: parathyroid hormone 2 receptor Calculated Molecular Weight: 550 aa, 62 kDa Observed Molecular Weight: 62-66 kDa GenBank Accession Number: BC036811 Gene Symbol: PTH2R Gene ID (NCBI): 5746 RRID: AB_2253212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49190 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924