Iright
BRAND / VENDOR: Proteintech

Proteintech, 14207-1-AP, MREG Polyclonal antibody

CATALOG NUMBER: 14207-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MREG (14207-1-AP) by Proteintech is a Polyclonal antibody targeting MREG in WB, ELISA applications with reactivity to human samples 14207-1-AP targets MREG in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information MREG, also known as DSU, belongs to the melanoregulin family. MREG is a small, highly charged protein thought to play a role in organelle biogenesis due to its effect on pigmentation in dilute, ashen, and leaden mutant mice (PMID: 19240024). Additionally, MREG probably functions as a cargo-recognition protein that couples cytoplasmic vesicles to the transport machinery. MREG has 2 isoforms with the molecular weights of 25 and 26 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5416 Product name: Recombinant human MREG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-214 aa of BC032747 Sequence: MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP Predict reactive species Full Name: melanoregulin Calculated Molecular Weight: 25kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC032747 Gene Symbol: MREG Gene ID (NCBI): 55686 RRID: AB_3085432 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N565 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924