Proteintech, 14234-1-AP, MPI Polyclonal antibody

Size: 20ul / 150ul The MPI (14234-1-AP) by Proteintech is a Polyclonal antibody targeting MPI in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14234-1-AP targets MPI in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HEK-293 cells, human brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MPI(mannose-6-phosphate isomerase) is also named as PMI1 and belongs to the mannose-6-phosphate isomerase type 1 family. It is a zinc metalloenzyme that catalyzes the reversible isomerization of mannose-6-phosphate and fructose-6-phosphate. MPI plays a critical role in maintaining the supply of D-mannose derivatives, which are required for most glycosylation reactions. This proterin has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5475 Product name: Recombinant human MPI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-423 aa of BC046357 Sequence: MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL Predict reactive species Full Name: mannose phosphate isomerase Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 40-47 kDa GenBank Accession Number: BC046357 Gene Symbol: MPI Gene ID (NCBI): 4351 RRID: AB_2146302 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P34949 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.