Proteintech, 14236-1-AP, SLC39A6/ZIP6 Polyclonal antibody

Size: 20ul / 150ul The SLC39A6/ZIP6 (14236-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A6/ZIP6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14236-1-AP targets SLC39A6/ZIP6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, A549 cells, 4T1 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The zinc transporter LIV-1 (also known as SLC39A6 or ZIP6) was originally identified as an estrogen-induced gene in breast cancer cells. Elevated LIV-1 expression is reportedly related to cancer progression in various types of cancer, including breast, prostate, pancreatic, cervical and liver cancers. While correlation of LIV-1 and prognosis may vary. LIV 1 has 3 isoforms with MW of 85-100 (glycosylation and phosphorylation), 48 and 32 kDa while migrates as different bands in different lysates in SDS-PAGE. Furthermore, it has been reported in the papers that full-length SLC39A6/ZIP6, as the pro-protein, is predicted to be 85 kDa and produces a 103 kDa band, the N-terminal fragment after cleavage is 35 kDa, and the cleaved ZIP6 is 68 kDa (PMID: 23919497, PMID: 26444413). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5478 Product name: Recombinant human SLC39A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-283 aa of BC039498 Sequence: HLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHH Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 6 Calculated Molecular Weight: 85 kDa Observed Molecular Weight: 85-103 kDa, 48 and 32 kDa GenBank Accession Number: BC039498 Gene Symbol: SLC39A6/ZIP6 Gene ID (NCBI): 25800 RRID: AB_10596924 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13433 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.