Proteintech, 14251-1-AP, MSRB3 Polyclonal antibody

Size: 20ul / 150ul The MSRB3 (14251-1-AP) by Proteintech is a Polyclonal antibody targeting MSRB3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14251-1-AP targets MSRB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5524 Product name: Recombinant human MSRB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC040053 Sequence: MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL Predict reactive species Full Name: methionine sulfoxide reductase B3 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC040053 Gene Symbol: MSRB3 Gene ID (NCBI): 253827 RRID: AB_2878035 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXL7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.