Proteintech, 14262-1-AP, VPS36 Polyclonal antibody

Size: 20ul / 150ul The VPS36 (14262-1-AP) by Proteintech is a Polyclonal antibody targeting VPS36 in WB, IHC, ELISA applications with reactivity to human samples 14262-1-AP targets VPS36 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells Positive IHC detected in: human pancreas cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5549 Product name: Recombinant human VPS36 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-386 aa of BC050439 Sequence: MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS Predict reactive species Full Name: vacuolar protein sorting 36 homolog (S. cerevisiae) Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 43 kDa, 65 kDa GenBank Accession Number: BC050439 Gene Symbol: VPS36 Gene ID (NCBI): 51028 RRID: AB_2878036 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86VN1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.