Proteintech, 14318-1-AP, CD141/Thrombomodulin Polyclonal antibody

Size: 20ul / 150ul The CD141/Thrombomodulin (14318-1-AP) by Proteintech is a Polyclonal antibody targeting CD141/Thrombomodulin in WB, IHC, ELISA applications with reactivity to human samples 14318-1-AP targets CD141/Thrombomodulin in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, A431 cells, human heart tissue, THP-1 cells Positive IHC detected in: human heart tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Thrombomodulin, also known as CD141, is an endothelial cell surface glycoprotein that forms a 1:1 complex with the coagulation factor thrombin and plays an important role as a natural anticoagulant. Thrombomodulin serves to convert thrombin from a procoagulant protein into the activator for protein C. Once converted to activated protein C (APC), this protein serves as a major anticoagulant in blood (PMID: 2827310). Thrombomodulin is also located in other cells (keratinocytes, osteoblasts, macrophages,...) where it might be involved in cell differentiation or in inflammation (PMID: 9814688). In humans, thrombomodulin is encoded by the THBD gene. Mutations in this gene are a cause of thromboembolic disease, also known as inherited thrombophilia. Thrombomodulin is glycosylated and has an apparent molecular weight of 75 to 110 kDa (PMID: 1650405; 2827310). Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5558 Product name: Recombinant human THBD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-350 aa of BC035602 Sequence: PAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECH Predict reactive species Full Name: thrombomodulin Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC035602 Gene Symbol: THBD Gene ID (NCBI): 7056 RRID: AB_2201814 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.