Proteintech, 14363-1-AP, RBM3 Polyclonal antibody

Size: 20ul / 150ul The RBM3 (14363-1-AP) by Proteintech is a Polyclonal antibody targeting RBM3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 14363-1-AP targets RBM3 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, A375 cells, Raji cells, HepG2 cells, Jurkat cells, NIH/3T3 cells Positive IHC detected in: human testis tissue, human lung tissue, human brain tissue, human kidney tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RBM3, also named as RNPL, is a cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. It reduces the relative abundance of microRNAs, when overexpressed. RBM3 enhances phosphoryaltion of translation initiation factors and active polysome formation. It is up-regulated in human tumors. RBM3 is a potential proto-oncogenic proteins upon overexpression. (PMID: 19900510 ). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, squirrel Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5934 Product name: Recombinant human RBM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC006825 Sequence: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN Predict reactive species Full Name: RNA binding motif (RNP1, RRM) protein 3 Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17-20 kDa GenBank Accession Number: BC006825 Gene Symbol: RBM3 Gene ID (NCBI): 5935 RRID: AB_2269266 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P98179 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.