Proteintech, 14409-1-AP, NOP58 Polyclonal antibody

Size: 20ul / 150ul The NOP58 (14409-1-AP) by Proteintech is a Polyclonal antibody targeting NOP58 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14409-1-AP targets NOP58 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells, MCF-7 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Background Information The box C/D snoRNPs,is named for the short, conserved box C (UGAUGA) and box D (CUGA) sequences present in their RNA moiety. The box C/D sequences are also required for multiple aspects. of snoRNA biogenesis, including: RNA stability, intronic processing, nucleolar targeting, nuclear retention, and 59 trimethylguanosine cap formation [PMID:9649444,8878486]. Nop58 is a component common to the box C/D small nucleolar ribonucleoproteins [PMID:10606270]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5740 Product name: Recombinant human NOP58 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 279-529 aa of BC032592 Sequence: MMAIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDRGIRKISGTGKALAKTEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEITEKKAKKAKIKVKVEEEEEEKVAEEEETSVKKKKKRGKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRENED Predict reactive species Full Name: NOP58 ribonucleoprotein homolog (yeast) Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC032592 Gene Symbol: NOP58 Gene ID (NCBI): 51602 RRID: AB_2152331 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2X3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.