Iright
BRAND / VENDOR: Proteintech

Proteintech, 14449-1-AP, KLHL2 Polyclonal antibody

CATALOG NUMBER: 14449-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KLHL2 (14449-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14449-1-AP targets KLHL2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, human brain tissue, MCF-7 cells, SH-SY5Y cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information KLHL2 contains an SH3-binding domain in the N terminus and a POZ domain and 6 tandem repeats of approximately 50 amino acids each in the C terminus. In astrocytoma/glioblastoma cells, KLHL2 colocalized with actin filaments in the cytoskeleton remodeling regions in stress fibers and in patchy cortical actin-rich regions of the cell margins. In primary rat hippocampal neurons, it was highly expressed in the cell body and in neurite processes(PMID: 10397770). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5950 Product name: Recombinant human KLHL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 273-593 aa of BC022503 Sequence: DYLIEAMKYHLLPTEQRILMKSVRTRLRTPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVGVLNNLLYAVGGHDGPLVRKSVEVYDPTTNAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVSSCMSTGRSYAGVTVIDKRL Predict reactive species Full Name: kelch-like 2, Mayven (Drosophila) Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC022503 Gene Symbol: KLHL2 Gene ID (NCBI): 11275 RRID: AB_2234221 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95198 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924