Iright
BRAND / VENDOR: Proteintech

Proteintech, 14454-1-AP, FANCL Polyclonal antibody

CATALOG NUMBER: 14454-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FANCL (14454-1-AP) by Proteintech is a Polyclonal antibody targeting FANCL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14454-1-AP targets FANCL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HEK-cells, Hela cells, HepG2 cells Positive IHC detected in: human kidney tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Fanconi anemia (FA) is a hereditary bone marrow failure syndrome associated with developmental defects and cancer predisposition. The FA nuclear core complex consists of FANCA, B, C, E, F, G, L, and M. FANCL is a RING-type E3 ubiquitin ligase that monoubiquitinates FANCD2 and FANCI, a key functional role facilitated by other members of the nuclear core complex (PMID: 23783032). FANCL plays an important role in the repair of cisplatin-induced DNA damage (PMID: 26385482) and participates directly in support of stem cell function (PMID: 23783032). FANCL can be detected as 40-43 kDa (full-length) and ~28 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6031 Product name: Recombinant human FANCL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-375 aa of BC054517 Sequence: MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGRKH Predict reactive species Full Name: Fanconi anemia, complementation group L Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC054517 Gene Symbol: FANCL Gene ID (NCBI): 55120 RRID: AB_10644333 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NW38 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924