Iright
BRAND / VENDOR: Proteintech

Proteintech, 14468-1-AP, AIG1 Polyclonal antibody

CATALOG NUMBER: 14468-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AIG1 (14468-1-AP) by Proteintech is a Polyclonal antibody targeting AIG1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14468-1-AP targets AIG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, mouse heart tissue, mouse testis tissue, PC-3 cells, rat heart tissue, rat ovary tissue, mouse ovary tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5836 Product name: Recombinant human AIG1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-238 aa of BC025278 Sequence: MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHHQYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQKSMEEEKEKPKLE Predict reactive species Full Name: androgen-induced 1 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28-32 kDa GenBank Accession Number: BC025278 Gene Symbol: AIG1 Gene ID (NCBI): 51390 RRID: AB_2273794 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVV5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924