Iright
BRAND / VENDOR: Proteintech

Proteintech, 14469-1-AP, EPN1 Polyclonal antibody

CATALOG NUMBER: 14469-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPN1 (14469-1-AP) by Proteintech is a Polyclonal antibody targeting EPN1 in WB, IF/ICC, ELISA applications with reactivity to human samples 14469-1-AP targets EPN1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HEK-293 cells, HeLa cells, K-562 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Epsin 1 (EPN1) belongs to the epsin family, which also includes EPN2 and EPN3. They belong to the endocytic clathrin family and are involved in receptor endocytosis. EPN1 is widely and highly expressed in tumors. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5838 Product name: Recombinant human EPN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 204-550 aa of BC044651 Sequence: RIRRGDDLRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPPVPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSPVPPVPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL Predict reactive species Full Name: epsin 1 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC044651 Gene Symbol: EPN1 Gene ID (NCBI): 29924 RRID: AB_3085436 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6I3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924