Iright
BRAND / VENDOR: Proteintech

Proteintech, 14532-1-AP, RELT Polyclonal antibody

CATALOG NUMBER: 14532-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RELT (14532-1-AP) by Proteintech is a Polyclonal antibody targeting RELT in WB, ELISA applications with reactivity to human samples 14532-1-AP targets RELT in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, HeLa cells, HL-60 cells, Jurkat cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6032 Product name: Recombinant human RELT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 189-430 aa of BC051810 Sequence: KGYHCTAHKEVGPGPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQKKWPEVLLSPEAVAATTPVPSLLPNPTRVPKVGAKAGRQGEITILSVGRFRVARIPEQRTSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSESNLVI Predict reactive species Full Name: RELT tumor necrosis factor receptor Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC051810 Gene Symbol: RELT Gene ID (NCBI): 84957 RRID: AB_2238423 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969Z4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924