Proteintech, 14543-1-AP, LZIC Polyclonal antibody

Size: 20ul / 150ul The LZIC (14543-1-AP) by Proteintech is a Polyclonal antibody targeting LZIC in WB, ELISA applications with reactivity to human samples 14543-1-AP targets LZIC in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, HepG2 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information LZIC is closely related to ICAT, a physiological inhibitor of the Wnt pathway that interacts physically and functionally with β-catenin to prevent the transcription of Wnt target genes. LZIC's ICAT-homologous region is highly similar to ICAT with particular conservation of residues that are used by ICAT for β-catenin-binding. LZIC does not interact with β-catenin in vitro or in vivo. LZIC is a protein conserved in vertebrates, is required for neuronal survival. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6047 Product name: Recombinant human LZIC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC063443 Sequence: MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK Predict reactive species Full Name: leucine zipper and CTNNBIP1 domain containing Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21-24 kDa GenBank Accession Number: BC063443 Gene Symbol: LZIC Gene ID (NCBI): 84328 RRID: AB_2138923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WZA0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.