Iright
BRAND / VENDOR: Proteintech

Proteintech, 14546-1-AP, LDHC Polyclonal antibody

CATALOG NUMBER: 14546-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LDHC (14546-1-AP) by Proteintech is a Polyclonal antibody targeting LDHC in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14546-1-AP targets LDHC in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MDA-MB-231 cells, PC-3 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LDHC, also named as CT32 and LDH-X, belongs to the LDH/MDH superfamily and LDH family. LDHC is a possible role in sperm motility. LDHC catalyzes the reaction: (S)-lactate + NAD+ = pyruvate + NADH. LDHC is a testis-specific isoform. Abnormal LDHC expression is associated with several forms of cancer. The antibody has no cross reaction with LDHA and LDHB. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6050 Product name: Recombinant human LDHC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC064388 Sequence: MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF Predict reactive species Full Name: lactate dehydrogenase C Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC064388 Gene Symbol: LDHC Gene ID (NCBI): 3948 RRID: AB_3085437 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07864 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924