Proteintech, 14548-1-AP, ARFIP2 Polyclonal antibody

Size: 20ul / 150ul The ARFIP2 (14548-1-AP) by Proteintech is a Polyclonal antibody targeting ARFIP2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14548-1-AP targets ARFIP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, human heart tissue, human liver tissue, mouse pancreas tissue Positive IHC detected in: human liver tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6076 Product name: Recombinant human ARFIP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 138-341 aa of BC000392 Sequence: RKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ Predict reactive species Full Name: ADP-ribosylation factor interacting protein 2 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa, 45 kDa GenBank Accession Number: BC000392 Gene Symbol: ARFIP2 Gene ID (NCBI): 23647 RRID: AB_2242930 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53365 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.