Proteintech, 14568-1-AP, JIP1/IB-1 Polyclonal antibody

Size: 20ul / 150ul The JIP1/IB-1 (14568-1-AP) by Proteintech is a Polyclonal antibody targeting JIP1/IB-1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14568-1-AP targets JIP1/IB-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue Positive IP detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human oesophagus cancer tissue, mouse brain tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6150 Product name: Recombinant human JIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 366-711 aa of BC068470 Sequence: SLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVSSPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEINVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADNRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE Predict reactive species Full Name: mitogen-activated protein kinase 8 interacting protein 1 Calculated Molecular Weight: 78 kDa Observed Molecular Weight: 97-116 kDa GenBank Accession Number: BC068470 Gene Symbol: MAPK8IP1/IB-1 Gene ID (NCBI): 9479 RRID: AB_2281682 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.