Proteintech, 14577-1-AP, SF3B3 Polyclonal antibody

Size: 20ul / 150ul SF3B3 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA 14577-1-AP targets SF3B3 in WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse heart tissue, human brain tissue, rat brain tissue, rat heart tissue, HeLa cells Positive IP detected in: rat brain tissue Positive IHC detected in: human lung cancer tissue, human gliomas tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Introns are removed from nuclear pre-mRNA in 2-step transesterification reactions. Splicing occured in a large ribonucleoprotein particle, called the spliceosome. Spliceosomal intermediate complexes form on pre-mRNA in the order E, A, B, and C, with the catalytic reactions occurring in complex C. U2 small nuclear ribonucleoproteins are one of the proteins essential for spliceosome assembly and mRNA splicing. Functional U2 snRNP is composed of a 12S unit and 2 splicing factors, SF3A, which is composed of 3 proteins, and SF3B, which conposed of 4 proteins. SF3B3 is one of SF3B, and it's required for 'A' complex assembly formed by the stable binding of U2 snRNP to the brachpoint sequence(BPS) in pre-mRNA. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5980 Product name: Recombinant human SF3B3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-399 aa of BC003146 Sequence: EDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF Predict reactive species Full Name: splicing factor 3b, subunit 3, 130kDa Calculated Molecular Weight: 136 kDa Observed Molecular Weight: 130-135 kDa GenBank Accession Number: BC003146 Gene Symbol: SF3B3 Gene ID (NCBI): 23450 RRID: AB_2270189 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15393 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.