Iright
BRAND / VENDOR: Proteintech

Proteintech, 14590-1-AP, FBXO2 Polyclonal antibody

CATALOG NUMBER: 14590-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FBXO2 (14590-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14590-1-AP targets FBXO2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, Caco-2 cells, HCT 116 cells, LoVo cells Positive IHC detected in: mouse brain tissue, rat brain tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information F-box only protein 2 (FBXO2), also known as FBG1 or Fbs1, is a cytoplasmic protein and ubiquitin ligase with high-mannose glycoprotein specificity. FBXO2 plays a significant role in regulating normal and abnormal neuron functions as a ubiquitin-mediated degrader of several neuron glycoproteins. In addition, it has been reported that FBXO2 targets insulin receptors for degradation by ubiquitin, thereby modulating insulin signaling. Recently, emerging evidence demonstrated that FBXO2 was also strongly associated with the occurrence and development of malignant tumors, including gastric cancer and colorectal cancer. The overexpression of FBXO2 significantly promotes PTC cell proliferation (PMID: 39343799). Lactic acid mediates the selective loading of FBXO2 into SEVs through SORBS3/FLOT1, thereby inducing hepatocyte apoptosis, which is an important mechanism of liver fibrosis caused by myogenic SEVs (PMID: 39879982). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6122 Product name: Recombinant human FBXO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-296 aa of BC025233 Sequence: MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP Predict reactive species Full Name: F-box protein 2 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33-40 kDa GenBank Accession Number: BC025233 Gene Symbol: FBXO2 Gene ID (NCBI): 26232 RRID: AB_2104394 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UK22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924