Proteintech, 14596-1-AP, BRN2 Polyclonal antibody

Size: 20ul / 150ul The BRN2 (14596-1-AP) by Proteintech is a Polyclonal antibody targeting BRN2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 14596-1-AP targets BRN2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IHC detected in: mouse brain tissue, human gliomas tissue, human placenta tissue, human skin tissue, human spleen tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue, human gliomas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. It shares a highly homologous region that referred to as the POU domain. POU3F2 is a Class III POU genes that expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. POU3F2 is required for maintaining neural cell differetiation and has a role in the production and positioning of neocortical neurons. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6131 Product name: Recombinant human POU3F2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-443 aa of BC051699 Sequence: SMGASNGGLLYSQPSFTVNGMLGAGGQSAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTPVQ Predict reactive species Full Name: POU class 3 homeobox 2 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC051699 Gene Symbol: BRN2 Gene ID (NCBI): 5454 RRID: AB_2167371 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20265 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.