Iright
BRAND / VENDOR: Proteintech

Proteintech, 14605-1-AP, DNM2 Polyclonal antibody

CATALOG NUMBER: 14605-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNM2 (14605-1-AP) by Proteintech is a Polyclonal antibody targeting DNM2 in WB, ELISA applications with reactivity to human, mouse, rat samples 14605-1-AP targets DNM2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, human brain tissue, MDA-MB-231 cells, human peripheral blood platelets, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information DNM2, also known as DYN2, DYNII, CMTDI1, CMTDIB, belongs to the dynamin family. DNM2 is a ubiquitously expressed large GTPase involved in clathrin-dependent and -independent endocytosis and intracellular membrane trafficking. DNM2 plays a role in the regulation of neuron morphology, axon growth, and the formation of neuronal growth cones. Dynamins are associated with microtubules. DNM2 plays an important role in endocytosis and is involved in cytokinesis (PMID: 33713620, 12498685). Mutations in DNM2 cause dominant centronuclear myopathy (PMID: 16227997). Defects in DNM2 are the cause of Charcot-Marie-Tooth disease dominant intermediate type B (CMTDIB) (PMID: 15731758). Alternate splicing results in multiple transcript variants. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6156 Product name: Recombinant human DNM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 518-866 aa of BC054501 Sequence: RRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD Predict reactive species Full Name: dynamin 2 Calculated Molecular Weight: 98 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC054501 Gene Symbol: DNM2 Gene ID (NCBI): 1785 RRID: AB_2277414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50570 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924