Proteintech, 14608-1-AP, PKN2 Polyclonal antibody

Size: 20ul / 150ul The PKN2 (14608-1-AP) by Proteintech is a Polyclonal antibody targeting PKN2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 14608-1-AP targets PKN2 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells, K-562 cells, HeLa cells, HEK-293 cells, COLO 320 cells, SKOV-3 cells, HEK-293T cells Positive IP detected in: COLO 320 cells Positive IHC detected in: human colon cancer tissue, human lung cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6164 Product name: Recombinant human PKN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC062620 Sequence: MDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPPREPRILSEEEQEMFRDFDYIADWC Predict reactive species Full Name: protein kinase N2 Calculated Molecular Weight: 112 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC062620 Gene Symbol: PKN2 Gene ID (NCBI): 5586 RRID: AB_10638487 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16513 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.