Proteintech, 14650-1-AP, MPP3 Polyclonal antibody

Size: 20ul / 150ul The MPP3 (14650-1-AP) by Proteintech is a Polyclonal antibody targeting MPP3 in IHC, ELISA applications with reactivity to human, mouse, rat samples 14650-1-AP targets MPP3 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information MPP3, also named as DLG3, belongs to the MAGUK family which interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. MPP3 plays an important role in signal transduction. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6246 Product name: Recombinant human MPP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-585 aa of BC056865 Sequence: KESKVFMRALFHYNPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKGFQERRLSYRRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGLRRSFRLGCRERLGGSQEGKMSSGAESPELLTYEEVARYQHQPGERPRLVVLIGSLGARLHELKQKVVAENPQHFGVAVPHTTRPRKSHEKEGVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALKQLRTSEFKPYIIFVKPAIQEKRKTPPMSPACEDTAAPFDEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQGAYSQLKVVLEKLSKDTHWVPVSWVR Predict reactive species Full Name: membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) Calculated Molecular Weight: 66 kDa GenBank Accession Number: BC056865 Gene Symbol: MPP3 Gene ID (NCBI): 4356 RRID: AB_10949194 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13368 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.