Iright
BRAND / VENDOR: Proteintech

Proteintech, 14658-1-AP, WIBG Polyclonal antibody

CATALOG NUMBER: 14658-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WIBG (14658-1-AP) by Proteintech is a Polyclonal antibody targeting WIBG in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14658-1-AP targets WIBG in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Protein WIBG homolog, also known as PYM1 (Partner of Y14 and mago), is a cytoplasmic RNA-binding protein, that can interact with the ribosome and EJC, may act as an EJC destabilizing factor, preventing EJC accumulation at positions away from exon-exon junctions (non-canonical position). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6276 Product name: Recombinant human WIBG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-204 aa of BC006135 Sequence: MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL Predict reactive species Full Name: within bgcn homolog (Drosophila) Calculated Molecular Weight: 23 kDa GenBank Accession Number: BC006135 Gene Symbol: WIBG Gene ID (NCBI): 84305 RRID: AB_3085439 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRP8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924