Proteintech, 14666-1-AP, ELK4 Polyclonal antibody

Size: 20ul / 150ul The ELK4 (14666-1-AP) by Proteintech is a Polyclonal antibody targeting ELK4 in WB, ELISA applications with reactivity to human, mouse, rat samples 14666-1-AP targets ELK4 in WB, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, MCF-7 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ELK4, also named as SAP1, SAP-1 and SAP1, belongs to the ETS family. It forms a ternary complex with the serum response factor (SRF). ELK4 requires DNA-bound SRF for ternary complex formation and makes extensive DNA contacts to the 5'side of SRF, but does not bind DNA autonomously. It is androgen regulated, involved in promoting cell growth, and highly expressed in a subset of prostate cancer. (PMID:19293179 ) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6273 Product name: Recombinant human ELK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-405 aa of BC063676 Sequence: MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM Predict reactive species Full Name: ELK4, ETS-domain protein (SRF accessory protein 1) Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC063676 Gene Symbol: ELK4 Gene ID (NCBI): 2005 RRID: AB_2262305 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28324 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.