Iright
BRAND / VENDOR: Proteintech

Proteintech, 14669-1-AP, SLC25A24 Polyclonal antibody

CATALOG NUMBER: 14669-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC25A24 (14669-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A24 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14669-1-AP targets SLC25A24 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse heart tissue, human placenta tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SLC25A24 (solute carrier family 25 member 24) is a gene encoding a mitochondrial ATP-Mg/phosphate transporter. It belongs to the mitochondrial carrier protein family and is mainly involved in mitochondrial energy metabolism and calcium signal regulation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6334 Product name: Recombinant human SLC25A24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-477 aa of BC068561 Sequence: ELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC068561 Gene Symbol: SLC25A24 Gene ID (NCBI): 29957 RRID: AB_10637267 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NUK1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924