Iright
BRAND / VENDOR: Proteintech

Proteintech, 14723-1-AP, GOLGA7 Polyclonal antibody

CATALOG NUMBER: 14723-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GOLGA7 (14723-1-AP) by Proteintech is a Polyclonal antibody targeting GOLGA7 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14723-1-AP targets GOLGA7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HL-60 cells, HepG2 cells Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GOLGA7 (Golgin subfamily A member 7) is an acylated Golgi protein that interacts with GCP170 protein (PMID: 14522980). The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. The ZDHHC5-GOLGA7 protein acyltransferase complex promotes nonapoptotic cell death (PMID: 31631010). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6460 Product name: Recombinant human GOLGA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC012032 Sequence: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR Predict reactive species Full Name: golgi autoantigen, golgin subfamily a, 7 Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC012032 Gene Symbol: GOLGA7 Gene ID (NCBI): 51125 RRID: AB_3085440 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z5G4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924