Proteintech, 14729-1-AP, PAFAH1B2 Polyclonal antibody

Size: 20ul / 150ul The PAFAH1B2 (14729-1-AP) by Proteintech is a Polyclonal antibody targeting PAFAH1B2 in WB, IP, ELISA applications with reactivity to human, mouse samples 14729-1-AP targets PAFAH1B2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue, mouse small intestine tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6489 Product name: Recombinant human PAFAH1B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC000398 Sequence: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA Predict reactive species Full Name: platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC000398 Gene Symbol: PAFAH1B2 Gene ID (NCBI): 5049 RRID: AB_2159909 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P68402 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.