Proteintech, 14738-1-AP, DEFB1 Polyclonal antibody

Size: 20ul / 150ul The DEFB1 (14738-1-AP) by Proteintech is a Polyclonal antibody targeting DEFB1 in IHC, ELISA applications with reactivity to human samples 14738-1-AP targets DEFB1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6406 Product name: Recombinant human DEFB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC047677 Sequence: MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK Predict reactive species Full Name: defensin, beta 1 Calculated Molecular Weight: 7 kDa GenBank Accession Number: BC047677 Gene Symbol: DEFB1 Gene ID (NCBI): 1672 RRID: AB_2091826 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P60022 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.