Iright
BRAND / VENDOR: Proteintech

Proteintech, 14765-1-AP, MRPL27 Polyclonal antibody

CATALOG NUMBER: 14765-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MRPL27 (14765-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL27 in IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14765-1-AP targets MRPL27 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IF/ICC detected in: A431 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6527 Product name: Recombinant human MRPL27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC001066 Sequence: MASVVLALRTRTAVTSLLSPTPATALAVRYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML Predict reactive species Full Name: mitochondrial ribosomal protein L27 Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC001066 Gene Symbol: MRPL27 Gene ID (NCBI): 51264 RRID: AB_2145890 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0M9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924