Proteintech, 14830-1-AP, UMPS Polyclonal antibody

Size: 20ul / 150ul The UMPS (14830-1-AP) by Proteintech is a Polyclonal antibody targeting UMPS in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 14830-1-AP targets UMPS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, HEK-293T cells, COLO 320 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information UMPS, also named as OPRT and ODC, plays an important role in pyrimidine synthesis, converting orotic acid to uridine 5′ monophosphate. UMPS has four isoforms with MW 53 kDa, 43 kDa, 33 kDa and 23 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6620 Product name: Recombinant human UMPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 189-480 aa of BC000364 Sequence: VDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV Predict reactive species Full Name: uridine monophosphate synthetase Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 52 kDa, 45 kDa GenBank Accession Number: BC000364 Gene Symbol: UMPS Gene ID (NCBI): 7372 RRID: AB_2212392 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11172 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.