Iright
BRAND / VENDOR: Proteintech

Proteintech, 14856-1-AP, CTRL Polyclonal antibody

CATALOG NUMBER: 14856-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CTRL (14856-1-AP) by Proteintech is a Polyclonal antibody targeting CTRL in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14856-1-AP targets CTRL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, BxPC-3 cells Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information CTRL(Chymotrypsin-like protease) is also named as CTRL1 and belongs to the peptidase S1 family. The CTRL1 enzyme is active over a broad pH range. It expresses in pancreas and presence in intestinal fluid after stimulation of pancreatic secretion as a digestive enzyme(PMID:9065485). This gene encode a protein of 264 amino acid and the protein has a signal peptide of 18 amino acid and a propeptide of 15 amino acid. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6644 Product name: Recombinant human CTRL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-264 aa of BC063475 Sequence: MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN Predict reactive species Full Name: chymotrypsin-like Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC063475 Gene Symbol: CTRL Gene ID (NCBI): 1506 RRID: AB_10640303 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40313 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924