Proteintech, 14869-1-AP, Calcipressin 1 Polyclonal antibody

Size: 20ul / 150ul The Calcipressin 1 (14869-1-AP) by Proteintech is a Polyclonal antibody targeting Calcipressin 1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 14869-1-AP targets Calcipressin 1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, SKOV-3 cells, human heart tissue, mouse skeletal muscle tissue, mouse heart tissue, A431 cells, mouse cerebellum tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6457 Product name: Recombinant human RCAN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC002864 Sequence: MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS Predict reactive species Full Name: regulator of calcineurin 1 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 25-29 kDa GenBank Accession Number: BC002864 Gene Symbol: RCAN1 Gene ID (NCBI): 1827 RRID: AB_10640904 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53805 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.