Iright
BRAND / VENDOR: Proteintech

Proteintech, 14885-1-AP, NGRN Polyclonal antibody

CATALOG NUMBER: 14885-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NGRN (14885-1-AP) by Proteintech is a Polyclonal antibody targeting NGRN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14885-1-AP targets NGRN in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human brain tissue, human heart tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NGRN, also named as Neugrin or FI58G, is a 291 amino acid protein, which belongs to the neugrin family. NGRN localizes in the nucleus and is expressed at high levels in heart, brain and skeletal muscle. In brain, it is mainly expressed in neurons rather than glial cells. NGRN may be involved in neuronal differentiation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6661 Product name: Recombinant human NGRN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC001682 Sequence: MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI Predict reactive species Full Name: neugrin, neurite outgrowth associated Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC001682 Gene Symbol: NGRN Gene ID (NCBI): 51335 RRID: AB_2878090 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPE2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924