Proteintech, 14910-1-AP, SERPINB9 Polyclonal antibody

Size: 20ul / 150ul The SERPINB9 (14910-1-AP) by Proteintech is a Polyclonal antibody targeting SERPINB9 in WB, ELISA applications with reactivity to human samples 14910-1-AP targets SERPINB9 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, Human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Background Information SERPINB9, also named as PI-9, belongs to the serpin family. SERPINB9 is an intracellular inhibitor of granzyme B (grB) that protects cytotoxic lymphocytes from grB-mediated death. It has a nucleo-cytoplasmic distribution and is produced in CD8+ T cells and natural killer cells (PMID: 28024184). Also, SERPINB9 is expressed by vascular SMCs and endothelial cells to avoid GZB-induced apoptosis (PMID: 28743062). The molecular weight of SERPINB9 is 42 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6707 Product name: Recombinant human SERPINB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-376 aa of BC002538 Sequence: METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP Predict reactive species Full Name: serpin peptidase inhibitor, clade B (ovalbumin), member 9 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC002538 Gene Symbol: SERPINB9 Gene ID (NCBI): 5272 RRID: AB_2254462 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50453 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.