Iright
BRAND / VENDOR: Proteintech

Proteintech, 14927-1-AP, TIM22 Polyclonal antibody

CATALOG NUMBER: 14927-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TIM22 (14927-1-AP) by Proteintech is a Polyclonal antibody targeting TIM22 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 14927-1-AP targets TIM22 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells, mouse liver tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TIM22 is a translocase localized in mitochondrial inner membrane. It is implicated in import of nuclear-encoded mitochondrial preproteins to the mitochondria. TIM22 is the essential core of protein insertion complex (TIM22 complex) that consists of TIM22, TIM54, TIM18, and TIM12. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6689 Product name: Recombinant human TIMM22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC002324 Sequence: MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR Predict reactive species Full Name: translocase of inner mitochondrial membrane 22 homolog (yeast) Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC002324 Gene Symbol: TIM22 Gene ID (NCBI): 29928 RRID: AB_11183050 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924