Proteintech, 14929-1-AP, POFUT1 Polyclonal antibody

Size: 20ul / 150ul POFUT1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA 14929-1-AP targets POFUT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, HUVEC cells Positive IP detected in: HepG2 cells Positive IHC detected in: human liver cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HUVEC cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information POFUT1 (protein O-fucosyltransferase 1), also known as GDP-fucose protein O-fucosyltransferase, is an enzyme that catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in EGF domains and plays a crucial role in Notch signaling. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6710 Product name: Recombinant human POFUT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC000582 Sequence: MGAAAWARPLSVSFLLLLLPLPGMPAGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRR Predict reactive species Full Name: protein O-fucosyltransferase 1 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC000582 Gene Symbol: POFUT1 Gene ID (NCBI): 23509 RRID: AB_2166123 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H488 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.