Proteintech, 14933-1-AP, GALNS Polyclonal antibody

Size: 20ul / 150ul The GALNS (14933-1-AP) by Proteintech is a Polyclonal antibody targeting GALNS in WB, IHC, ELISA applications with reactivity to human samples 14933-1-AP targets GALNS in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, human liver tissue, HepG2 cells, HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GALNS(N-acetylgalactosamine-6-sulfatase) is also named as chondroitinase and belongs to the sulfatase family. It is one of sulfatases required to degrade glycosaminoglycans (GAGs), keratan sulfate (KS) and chondroitin-6-sulfate (C6S) and the enzyme is a dimer derived from two 60 kDa polypeptides, each of which is processed to 40 kDa and 15 kDa polypeptide subunits linked by disulfide bonds(PMID:15241807). The deduced 522-residue protein is composed of a 26-amino acid N-terminal signal peptide and a mature polypeptide of 496 amino acid residues, including 2 potential asparagine-linked glycosylation sites(PMID:1755850). Defects in GALNS are the cause of mucopolysaccharidosis type 4A (MPS4A), also known as Morquio A syndrome. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6746 Product name: Recombinant human GALNS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-522 aa of BC050684 Sequence: ARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYLQEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSLALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH Predict reactive species Full Name: galactosamine (N-acetyl)-6-sulfate sulfatase Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC050684 Gene Symbol: GALNS Gene ID (NCBI): 2588 RRID: AB_2108720 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P34059 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.