Proteintech, 14942-1-AP, RPS15A Polyclonal antibody

Size: 20ul / 150ul The RPS15A (14942-1-AP) by Proteintech is a Polyclonal antibody targeting RPS15A in WB, IHC, ELISA applications with reactivity to human samples 14942-1-AP targets RPS15A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RPS15A is a component of the small ribosomal subunit, it is required for proper erythropoiesis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6655 Product name: Recombinant human RPS15A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC001697 Sequence: MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISPRSDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF Predict reactive species Full Name: ribosomal protein S15a Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 13-15 kDa GenBank Accession Number: BC001697 Gene Symbol: RPS15A Gene ID (NCBI): 6210 RRID: AB_3085446 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62244 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.