Proteintech, 14943-1-AP, OVCA2 Polyclonal antibody

Size: 20ul / 150ul The OVCA2 (14943-1-AP) by Proteintech is a Polyclonal antibody targeting OVCA2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14943-1-AP targets OVCA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human kidney tissue, human brain tissue, mouse thymus tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6744 Product name: Recombinant human OVCA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC041170 Sequence: MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE Predict reactive species Full Name: candidate tumor suppressor in ovarian cancer 2 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC041170 Gene Symbol: OVCA2 Gene ID (NCBI): 124641 RRID: AB_2157286 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WZ82 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.