Proteintech, 14947-1-AP, Cyclon/CCDC86 Polyclonal antibody

Size: 20ul / 150ul The Cyclon/CCDC86 (14947-1-AP) by Proteintech is a Polyclonal antibody targeting Cyclon/CCDC86 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14947-1-AP targets Cyclon/CCDC86 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse stomach tissue, HepG2 cells, human heart tissue, human liver tissue, human stomach tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CCDC86 (Coiled-coil domain-containing protein 86), also known as Cyclon (cytokine-induced protein with coiled-coil domain) ) is known for its expression in leukocytes in mice, where it regulates the immune response. Cyclon/CCDC86 regulates the apoptosis of T-cells upon activation, a process known as an activationinduced cellular death (AICD), by regulating the expression of the death receptor Fas on T-cells (PMID: 23439384). CCDC86 depletion led to a novel phenotype in which Ki-67 and nucleolin could still accumulate at the chromosome periphery but also formed abnormal cytoplasmic NDF-like foci (PMID: 36695333). The detected molecular weights (MWs) of Cyclon on SDS-PAGE (human Cyclon: 65 kDa; mouse Cyclon: 75 kDa) were higher than calculated MWs (human Cyclon: 40.2 kDa; mouse Cyclon: 46.5 kDa), suggesting possible modifications of Cyclon (PMID: 17300783). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6754 Product name: Recombinant human CCDC86 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-360 aa of BC001378 Sequence: MDTPLRRSRRLGGLRPESPESLTSVSRTRRALVEFESNPEETREPGSPPSVQRAGLGSPERPPKTSPGSPRLQQGAGLESPQGQPEPGAASPQRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAPQHQLPPVPGSPEPYPGQQAPGPEPSQPLLELTPRAPGSPRGQHEPSKPPPAGETVTGGFGAKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKRAKKKQLRSIEKRDTLALLQKQPPQQPAAKI Predict reactive species Full Name: coiled-coil domain containing 86 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC001378 Gene Symbol: CCDC86 Gene ID (NCBI): 79080 RRID: AB_2072318 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6F5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.