Proteintech, 14954-1-AP, Kir6.1 Polyclonal antibody

Size: 20ul / 150ul The Kir6 14954-1-AP targets Kir6.1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: unboiled HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6792 Product name: Recombinant human KCNJ8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-424 aa of BC000544 Sequence: TAQAHRRAETLIFSRHAVIAVRNGKLCFMFRVGDLRKSMIISASVRIQVVKKTTTPEGEVVPIHQLDIPVDNPIESNNIFLVAPLIICHVIDKRSPLYDISATDLANQDLEVIVILEGVVETTGITTQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVKVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKVQFMTPEGNQNTSES Predict reactive species Full Name: potassium inwardly-rectifying channel, subfamily J, member 8 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC000544 Gene Symbol: Kir6.1 Gene ID (NCBI): 3764 RRID: AB_2130768 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15842 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.