Proteintech, 14970-1-AP, TRMT1 Polyclonal antibody

Size: 20ul / 150ul The TRMT1 (14970-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14970-1-AP targets TRMT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:600-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information TRMT1 is an RNA methyltransferase responsible for the formation of N2,N2-dimethylguanosine (m2,2G) at position 26 in both cytosolic and mitochondrial tRNAs.TRMT1-catalyzed tRNA modifications are important for maintenance of global protein translation levels including proteins involved in cellular growth, development, and stress response. Human neural stem cells with TRMT1 knockdowns were found to have hypersensitivity to redox stress, implicating TRMT1 and the m2,2G26 modification in the regulation of redox homeostasis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6837 Product name: Recombinant human TRMT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 371-659 aa of BC002492 Sequence: KFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPGRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLSHACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDANPSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAARLKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGPGAAAGPGID Predict reactive species Full Name: TRM1 tRNA methyltransferase 1 homolog (S. cerevisiae) Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC002492 Gene Symbol: TRMT1 Gene ID (NCBI): 55621 RRID: AB_2209504 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NXH9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.