Proteintech, 15003-1-AP, RENALASE Polyclonal antibody

Size: 20ul / 150ul The RENALASE (15003-1-AP) by Proteintech is a Polyclonal antibody targeting RENALASE in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 15003-1-AP targets RENALASE in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RNLS, also named as Renalase, C10orf59 and MAO-C, belongs to the renalase family. It is probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. RNLS degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. It lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis. RNLS has physiologically relevant catecholamine-oxidizing activity. (PMID:15841207 ) This antibody is specific to RNLS. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13061 Product name: Recombinant human RENALASE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-342 aa of BC005364 Sequence: MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI Predict reactive species Full Name: chromosome 10 open reading frame 59 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC005364 Gene Symbol: RENALASE Gene ID (NCBI): 55328 RRID: AB_1557298 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VYX0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.