Proteintech, 15005-1-AP, Trypsin 2/PRSS2 Polyclonal antibody

Size: 20ul / 150ul The Trypsin 2/PRSS2 (15005-1-AP) by Proteintech is a Polyclonal antibody targeting Trypsin 2/PRSS2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15005-1-AP targets Trypsin 2/PRSS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, HepG2 cells, mouse thymus tissue Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information The human pancreas produces three isoforms of trypsinogen encoded by separate genes, the PRSS1 (protease, serine 1), PRSS2, and PRSS3 genes. PRSS2 is also named as TRY2(trypsin-2), TRYP2. In the ileum, it may be involved in defensin processing, including DEFA5. The preproprotein comprises 247 amino acids, including a 15-amino acid signal peptide and an 8-amino acid activation peptide. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6461 Product name: Recombinant human PRSS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-239 aa of BC030260 Sequence: MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWI Predict reactive species Full Name: protease, serine, 2 (trypsin 2) Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa, 35 kDa GenBank Accession Number: BC030260 Gene Symbol: PRSS2 Gene ID (NCBI): 5645 RRID: AB_2171841 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07478 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.