Iright
BRAND / VENDOR: Proteintech

Proteintech, 15015-1-AP, CNIH4 Polyclonal antibody

CATALOG NUMBER: 15015-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CNIH4 (15015-1-AP) by Proteintech is a Polyclonal antibody targeting CNIH4 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 15015-1-AP targets CNIH4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CNIH4 (Cornichon Family Member 4) is a protein-coding gene belonging to the cornichon family, which plays a critical role in regulating G protein-coupled receptor (GPCR) trafficking from the endoplasmic reticulum to the cell surface. It facilitates GPCR export through the early secretory pathway and is regulated by TMED9. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6965 Product name: Recombinant human CNIH4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC000573 Sequence: MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLG Predict reactive species Full Name: cornichon homolog 4 (Drosophila) Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16-18 kDa GenBank Accession Number: BC000573 Gene Symbol: CNIH4 Gene ID (NCBI): 29097 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P003 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924