Proteintech, 15021-1-AP, CITED2 Polyclonal antibody

Size: 20ul / 150ul The CITED2 (15021-1-AP) by Proteintech is a Polyclonal antibody targeting CITED2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15021-1-AP targets CITED2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue Positive IHC detected in: mouse brain tissue, mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CITED2, also named as P35srj, is a cAMP-responsive element-binding protein (CBP)/p300-transactivator, with an ED(Glu/Asp)-rich C-terminal domain that acts as an important modulator in the development of the heart [PMID:10552932]. There are two isoforms of CITED2 protein and the calculated molecular weight of them are 24kDa and 28 kDa. The 28 kDa isoform having modification site may migrate to 35 kDa and 24 kDa isoform having modification site may migrate to 27 kDa (PMID: 23082118). It is proposed to be a negative regulator of HIF-1α through its competitive binding to the CH1 domain of CBP/p300, which mediated signaling and to a decrease in HIF-1-responsive genes such as VEGF [PMID:9887100]. In addition, it is also a co-activator of the transcriptional activity of the TFAP2 isoform, which is an extensively expressed nuclear protein with functions in embryogenesis, inflammation, and stress responses[PMID:22735262]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7078 Product name: Recombinant human CITED2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-270 aa of BC004377 Sequence: MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHPAAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC Predict reactive species Full Name: Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 36 kDa, 27 kDa GenBank Accession Number: BC004377 Gene Symbol: CITED2 Gene ID (NCBI): 10370 RRID: AB_2080545 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99967 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.