Iright
BRAND / VENDOR: Proteintech

Proteintech, 15024-1-AP, ARHGAP32 Polyclonal antibody

CATALOG NUMBER: 15024-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARHGAP32 (15024-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP32 in WB, IHC, ELISA applications with reactivity to human, mouse samples 15024-1-AP targets ARHGAP32 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: mouse testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ARHGAP32, also known as RICS, belongs to the PX domain-containing GAP family. ARHGAP32 encodes a neuron-associated GTPase-activating protein that regulates dendritic spine morphology and strength. ARHGAP32 also can interact with RhoA and β-catenin, thereby inhibiting phosphorylation of LIMK/cofilin and promoting epithelial-to-mesenchymal transition (EMT) process. ARHGAP32 is highly expressed in brain and testis (PMID: 30888095, PMID: 32205841). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7104 Product name: Recombinant human RICS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-322 aa of BC000277 Sequence: VLSTWWRGKHGFQVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRHEFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFILNHVDVLLPHFSARTELIVPFPLRLLRKQFTPPLLGPMSPLNPLVQITVCISI Predict reactive species Full Name: Rho GTPase-activating protein Calculated Molecular Weight: 231 kDa Observed Molecular Weight: 220 kDa GenBank Accession Number: BC000277 Gene Symbol: ARHGAP32 Gene ID (NCBI): 9743 RRID: AB_3085448 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A7KAX9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924