Proteintech, 15043-1-AP, AP1S2 Polyclonal antibody

Size: 20ul / 150ul The AP1S2 (15043-1-AP) by Proteintech is a Polyclonal antibody targeting AP1S2 in WB, ELISA applications with reactivity to human, rat samples 15043-1-AP targets AP1S2 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat epididymis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information AP1S2 is a subunit of the adaptor complex AP-1. It belongs to the adaptor complexes small subunit family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6911 Product name: Recombinant human AP1S2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC001117 Sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT Predict reactive species Full Name: adaptor-related protein complex 1, sigma 2 subunit Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 19-24 kDa GenBank Accession Number: BC001117 Gene Symbol: AP1S2 Gene ID (NCBI): 8905 RRID: AB_3669197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56377 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.